PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016444771.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 447aa    MW: 47875.1 Da    PI: 4.8008
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016444771.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.59.7e-1698142347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++++  ++G+g+Wk+I+r+  + Rt+ q+ s+ qk+
   XP_016444771.1  98 AWTEEEHKLFLKGLDKYGKGDWKSISRHCVLSRTPQQVASHAQKF 142
                      7******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.1859IPR001005SANT/Myb domain
SuperFamilySSF466891.1E-71063IPR009057Homeodomain-like
PROSITE profilePS500904.7161257IPR017877Myb-like domain
CDDcd001677.99E-41257No hitNo description
PROSITE profilePS5129419.94291147IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-1192144IPR009057Homeodomain-like
SuperFamilySSF466893.8E-1693147IPR009057Homeodomain-like
TIGRFAMsTIGR015574.6E-1695145IPR006447Myb domain, plants
SMARTSM007171.6E-1195145IPR001005SANT/Myb domain
PfamPF002494.2E-1298141IPR001005SANT/Myb domain
CDDcd001675.01E-1198143No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 447 aa     Download sequence    Send to blast
MSTDRTCNGS FWTKEEDKIF ENTLAVYSSD DDLLMRMAAA LPGKSLEDIK NHYEVLVEDV  60
NAIESGLVPL PRYRNMQSHS RNKSRLPKAD VERRKGVAWT EEEHKLFLKG LDKYGKGDWK  120
SISRHCVLSR TPQQVASHAQ KFFNRREGVN KERRRASIHD ITSVDIETAG TSQVPNPENM  180
IGPAGGGSQV TASTNDTTGA VDSGVVSTGV GTFTSPIAAI EMKSMLPQEI TVAEPVIAVS  240
GGESSGPGAA SVNEVNRLYH DVNDDFILGI DDLIMEQEGT YEAGIHGDTE RSLLPSLQSS  300
TAAGNENYGH PVTRIGSELE ALITEHMVED NEISSIFDVG KTPSSHAMLS SAAHSGMSSY  360
AVAAHSGMSS YTVAAHSGIS SYTVGSFGFN NAPENRVAAP GGGLTIDSQQ LPSIAPSSNF  420
GVGVCPNSNT CVRDEGIFYL GDLFPDI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-13881785RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016444771.10.0PREDICTED: uncharacterized protein LOC107770029
TrEMBLM0ZND11e-121M0ZND1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000043921e-121(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA44541329
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.13e-58MYB family protein